Loading...
Statistics
Advertisement

#STEPHELLY
www.kellyandstephanie.net/

Kellyandstephanie.net

Advertisement
Kellyandstephanie.net is hosted in United States / San Francisco . Kellyandstephanie.net uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 0. Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Kellyandstephanie.net

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Kellyandstephanie.net

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 279551288137547401187213885128844701738453
    • validFrom: 160815135100Z
    • validTo: 161113135100Z
    • validFrom_time_t: 1471269060
    • validTo_time_t: 1479045060
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 18:F2:92:69:A6:0F:FB:56:03:02:1C:52:B9:36:6D:31:2D:82:6B:0C
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:kellyakenna.com, DNS:kellyamidonblog.com, DNS:kellyandbillmay.com, DNS:kellyanddad.com, DNS:kellyanddaviesdogwalking.com, DNS:kellyandellieimperfectdietitians.com, DNS:kellyandersen.com, DNS:kellyandforrest.com, DNS:kellyandgeoff.com, DNS:kellyandjekelduo.com, DNS:kellyandjordan2014.com, DNS:kellyandjordi.com, DNS:kellyandkate.com, DNS:kellyandkeithwedding.com, DNS:kellyandmartinwedding.com, DNS:kellyandrewspoetry.com, DNS:kellyandsoe.com, DNS:kellyandstephanie.net, DNS:kellyannatkins.com, DNS:kellyanncarroll.com, DNS:kellyannechen.com, DNS:kellyanneharris.com, DNS:kellyannewang.com, DNS:kellyannfrederick.com, DNS:kellyanngoyette.com, DNS:kellyannlindsey.com, DNS:tls.automattic.com, DNS:www.kellyamidonblog.com, DNS:www.kellyandbillmay.com, DNS:www.kellyanddad.com, DNS:www.kellyanddaviesdogwalking.com, DNS:www.kellyandellieimperfectdietitians.com, DNS:www.kellyandersen.com, DNS:www.kellyandforrest.com, DNS:www.kellyandgeoff.com, DNS:www.kellyandjekelduo.com, DNS:www.kellyandjordan2014.com, DNS:www.kellyandjordi.com, DNS:www.kellyandkate.com, DNS:www.kellyandkeithwedding.com, DNS:www.kellyandmartinwedding.com, DNS:www.kellyandrewspoetry.com, DNS:www.kellyandsoe.com, DNS:www.kellyandstephanie.net, DNS:www.kellyannatkins.com, DNS:www.kellyanncarroll.com, DNS:www.kellyannechen.com, DNS:www.kellyanneharris.com, DNS:www.kellyannewang.com, DNS:www.kellyannfrederick.com, DNS:www.kellyanngoyette.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Kellyandstephanie.net

Number of occurences: 10
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: robots
    Content: noindex,follow
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: #STEPHELLY
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: #STEPHELLY on WordPress.com

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 11 Sep 2016 03:26:23 GMT Content-Type: text/html Content-Length: 178 Location: https://www.kellyandstephanie.net/ X-ac: 3.dfw _dfw X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 11 Sep 2016 03:26:24 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Strict-Transport-Security: max-age=86400 Location: https://kellyandstephanie.net/ X-ac: 3.dfw _dfw HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sun, 11 Sep 2016 03:26:24 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.dfw _dfw

DNS

host: kellyandstephanie.net
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: kellyandstephanie.net
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: kellyandstephanie.net
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: kellyandstephanie.net
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: kellyandstephanie.net
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: kellyandstephanie.net
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ellyandstephanie.net, www.ktellyandstephanie.net, www.tellyandstephanie.net, www.kellyandstephanie.net, www.ellyandstephanie.net, www.kgellyandstephanie.net, www.gellyandstephanie.net, www.kbellyandstephanie.net, www.bellyandstephanie.net, www.knellyandstephanie.net, www.nellyandstephanie.net, www.khellyandstephanie.net, www.hellyandstephanie.net, www.kyellyandstephanie.net, www.yellyandstephanie.net, www.klellyandstephanie.net, www.lellyandstephanie.net, www.koellyandstephanie.net, www.oellyandstephanie.net, www.kuellyandstephanie.net, www.uellyandstephanie.net, www.kiellyandstephanie.net, www.iellyandstephanie.net, www.kmellyandstephanie.net, www.mellyandstephanie.net, www.kllyandstephanie.net, www.kexllyandstephanie.net, www.kxllyandstephanie.net, www.kesllyandstephanie.net, www.ksllyandstephanie.net, www.kewllyandstephanie.net, www.kwllyandstephanie.net, www.kerllyandstephanie.net, www.krllyandstephanie.net, www.kefllyandstephanie.net, www.kfllyandstephanie.net, www.kevllyandstephanie.net, www.kvllyandstephanie.net, www.kecllyandstephanie.net, www.kcllyandstephanie.net, www.keqllyandstephanie.net, www.kqllyandstephanie.net, www.keallyandstephanie.net, www.kallyandstephanie.net, www.keyllyandstephanie.net, www.kyllyandstephanie.net, www.kelyandstephanie.net, www.kelulyandstephanie.net, www.keulyandstephanie.net, www.kel8lyandstephanie.net, www.ke8lyandstephanie.net, www.kel9lyandstephanie.net, www.ke9lyandstephanie.net, www.keljlyandstephanie.net, www.kejlyandstephanie.net, www.kel0lyandstephanie.net, www.ke0lyandstephanie.net, www.kelmlyandstephanie.net, www.kemlyandstephanie.net, www.kelplyandstephanie.net, www.keplyandstephanie.net, www.kelolyandstephanie.net, www.keolyandstephanie.net, www.kelyandstephanie.net, www.kelluyandstephanie.net, www.keluyandstephanie.net, www.kell8yandstephanie.net, www.kel8yandstephanie.net, www.kell9yandstephanie.net, www.kel9yandstephanie.net, www.kelljyandstephanie.net, www.keljyandstephanie.net, www.kell0yandstephanie.net, www.kel0yandstephanie.net, www.kellmyandstephanie.net, www.kelmyandstephanie.net, www.kellpyandstephanie.net, www.kelpyandstephanie.net, www.kelloyandstephanie.net, www.keloyandstephanie.net, www.kellandstephanie.net, www.kellyzandstephanie.net, www.kellzandstephanie.net, www.kellyaandstephanie.net, www.kellaandstephanie.net, www.kellysandstephanie.net, www.kellsandstephanie.net, www.kellydandstephanie.net, www.kelldandstephanie.net, www.kellyandstephanie.net, www.kellandstephanie.net, www.kellycandstephanie.net, www.kellcandstephanie.net, www.kelly andstephanie.net, www.kell andstephanie.net, www.kellyndstephanie.net, www.kellyaondstephanie.net, www.kellyondstephanie.net, www.kellyapndstephanie.net, www.kellypndstephanie.net, www.kellya9ndstephanie.net, www.kelly9ndstephanie.net, www.kellyandstephanie.net, www.kellyndstephanie.net, www.kellyaindstephanie.net, www.kellyindstephanie.net, www.kellyaundstephanie.net, www.kellyundstephanie.net, www.kellyadstephanie.net, www.kellyanndstephanie.net, www.kellyandstephanie.net, www.kellyanhdstephanie.net, www.kellyahdstephanie.net, www.kellyanjdstephanie.net, www.kellyajdstephanie.net, www.kellyankdstephanie.net, www.kellyakdstephanie.net, www.kellyanldstephanie.net, www.kellyaldstephanie.net, www.kellyan dstephanie.net, www.kellya dstephanie.net, www.kellyanstephanie.net, www.kellyandtstephanie.net, www.kellyantstephanie.net, www.kellyandgstephanie.net, www.kellyangstephanie.net, www.kellyandbstephanie.net, www.kellyanbstephanie.net, www.kellyandxstephanie.net, www.kellyanxstephanie.net, www.kellyandsstephanie.net, www.kellyansstephanie.net, www.kellyandfstephanie.net, www.kellyanfstephanie.net, www.kellyandvstephanie.net, www.kellyanvstephanie.net, www.kellyandystephanie.net, www.kellyanystephanie.net, www.kellyandzstephanie.net, www.kellyanzstephanie.net, www.kellyandastephanie.net, www.kellyanastephanie.net, www.kellyandestephanie.net, www.kellyanestephanie.net, www.kellyandrstephanie.net, www.kellyanrstephanie.net, www.kellyandtephanie.net, www.kellyandsetephanie.net, www.kellyandetephanie.net, www.kellyandswtephanie.net, www.kellyandwtephanie.net, www.kellyandsdtephanie.net, www.kellyanddtephanie.net, www.kellyandsxtephanie.net, www.kellyandxtephanie.net, www.kellyandsftephanie.net, www.kellyandftephanie.net, www.kellyandsgtephanie.net, www.kellyandgtephanie.net, www.kellyandsttephanie.net, www.kellyandttephanie.net,

Other websites we recently analyzed

  1. malcolmyam.com | explorer in a world that is ever changing
    Provo (United States) - 69.89.31.71
    Server software: nginx/1.10.0
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 25
    Number of meta tags: 3
  2. Snow Orchid Studios - Custom Graphics for Web and Print!
    Graphic Design and Other Stuff
    Scottsdale (United States) - 23.229.191.7
    Server software: Apache/2.4.23
    Technology: CSS, Google Font API, Html, Html5, jQuery, Php, Wordpress
    Number of Javascript: 1
    Number of meta tags: 3
  3. IndianapolisDirect.info - When you want to know Indianapolis, Indiana
    Indianapolis, Indiana: Indianapolis's Online Community - a Indianapolis web directory, guide, and portal serving Indianapolis, Indiana and area
    San Francisco (United States) - 104.28.5.20
    G Analytics ID: UA-56662502-1
    Server software: cloudflare-nginx
    Technology: CloudFlare, CSS, Html, Html5, Javascript, jQuery UI, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 13
  4. Sergio Carpathos
    Bodybuilding
    Houston (United States) - 192.185.32.235
    G Analytics ID: UA-XXXXXXXX-X
    Server software: nginx/1.10.1
    Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 39
    Number of meta tags: 5
  5. Landschaft Licht und mehr - Home
    Landschaft Licht und mehr
    Germany - 46.252.18.208
    Server software: Apache/2.4.20
    Technology: CSS, Html
    Number of meta tags: 7
  6. Man & Mouse
    Man & Mouse utvecklar applikationer för iOS - iPhone, iPad och iPod Touch. Vi utvecklar även databassystem samt erbjuder support och kurser i Mac-miljö.
    Sweden - 195.74.38.98
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 4
    Number of meta tags: 5
  7. cbles.xyz
    Los Angeles (United States) - 23.88.40.167
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 9
    Number of meta tags: 5
  8. Donoghoe Dot Com
    Mountain View (United States) - 64.233.184.214
    Server software: GSE
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  9. ShireDrive - Driving school offering manual and automatic driving lessons. Book a driving lesson with ShireDrive, covering Hertfordshire, St Albans, Watford, Harpenden, Hemel Hempstead, Hatfield, Welwyn Garden City and Stevenage with male and female drivi
    United Kingdom - 84.18.198.110
    Server software: Apache/2.2.24 (Red Hat)
    Technology: CSS, Html, Javascript, jQuery, jQuery Bgiframe, jQuery Cycle, jQuery Fancybox, Php, Pingback, SuperFish, Google Analytics, Wordpress
    Number of Javascript: 16
    Number of meta tags: 1
  10. xn--brger-ticket-dlb.de
    Germany - 87.238.192.166
    Server software: Apache
    Technology: Html
    Number of meta tags: 5

Check Other Websites